PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16798.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 421aa    MW: 47671.8 Da    PI: 8.5665
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16798.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.11.1e-062142531954
                 HHH..SSS--HHHHHHHHHHCTS-HHH..HHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterq..VkvWFqNrRak 54 
                 Fe   ++yps  ++  LA+++gL+++q  V++WF N R +
  KHN16798.1 214 FEHflHPYPSDVDKHILARQTGLSKSQarVSNWFINARVR 253
                 564459*****************986544*********88 PP

2BELL99.92e-3278145272
        BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 + elqk+k++Ll +leeVd+rYk+y++q+++v+ssFea    g+a++Y +lAlka+SrhFrcLkd i++qi
  KHN16798.1  78 FVELQKRKTRLLAMLEEVDRRYKHYRDQMKAVMSSFEA---NGAATVYSALALKAMSRHFRCLKDGIMDQI 145
                 679**********************************7...79***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.7E-4917143IPR006563POX domain
PfamPF075264.7E-4023141IPR006563POX domain
PROSITE profilePS500719.912192257IPR001356Homeobox domain
CDDcd000861.38E-9195258No hitNo description
SMARTSM003893.3E-6195261IPR001356Homeobox domain
SuperFamilySSF466893.59E-14196263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-25198263IPR009057Homeodomain-like
PfamPF059205.5E-16212253IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MLQDGYLSPN KAANIYQQGH FLIKNSKFLV PSQVLLNEFC SLGTKENDVP KQKNKQWEEG  60
NNNGGGSSKN HSLSSLEFVE LQKRKTRLLA MLEEVDRRYK HYRDQMKAVM SSFEANGAAT  120
VYSALALKAM SRHFRCLKDG IMDQIRATRK GMGEKELAAV PGTTRGETPR LKIIDQSLRQ  180
QRAFQQISIM ETHPWRPQRG LPERSVSVLR AWLFEHFLHP YPSDVDKHIL ARQTGLSKSQ  240
ARVSNWFINA RVRLWKPMVE EMYLEEEKEH QNDVASSEGG GINILGDQKP TQARLVRIDS  300
ECMSSIVNNP DDKNDTKSGK TIQNDNQMDA FGSVELDFWS YTHQYSSGHS GGVSLTLGLQ  360
QHGESGVSLA FPPAATQSSM FYPRDQIEDC QTVQYSLVDG KGQNMPYRNL MGTHLLHDHL  420
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-14201261563Homeobox protein Meis2
3k2a_B4e-14201261563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-95AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532909.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-132BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0B2Q9V40.0A0A0B2Q9V4_GLYSO; Homeobox protein BEL1 like
STRINGGLYMA08G02020.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-123TALE family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]